SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4I1B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4I1B7
Domain Number 1 Region: 52-175,204-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-27
Family Nucleotide and nucleoside kinases 0.00027
Further Details:      
 
Domain Number 2 Region: 9-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0089
Further Details:      
 
Weak hits

Sequence:  A0A1G4I1B7
Domain Number - Region: 174-196
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000743
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4I1B7
Sequence length 260
Comment (tr|A0A1G4I1B7|A0A1G4I1B7_TRYEQ) Adenylate kinase, putative {ECO:0000313|EMBL:SCU65480.1} KW=Complete proteome OX=5694 OS=Trypanosoma equiperdum. GN=TEOVI_000020500 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MSTGQLSADAVKYLEEKRVTYLLEELFHDVLRNLPENPLEFLLKALERKTTLHLIIVGPP
GSGKQTQARRIAKRYDAVHVRAQDIFLNEVKRRTPEGEIIERCMRDGEQVPSHISSELVI
RRLREDDVVKRGWVLDGFPQTRSQALRLQTAGLSPLLFIMLDVGNEVSVKRCAGRRYEPI
TRNIYHIEYLPAPSGMHLELMSPDDESRAAVASRWKYFDARRGELVGCYEPMYVRIDGDR
PFDTVFAEVCEQVDSRFVSV
Download sequence
Identical sequences A0A1G4I1B7 Q57U69
Tb927.5.3970 gi|72389544|ref|XP_845067.1| XP_845067.1.54365 5691.Tb927.5.3970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]