SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4I5Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4I5Y9
Domain Number 1 Region: 17-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000275
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G4I5Y9
Sequence length 76
Comment (tr|A0A1G4I5Y9|A0A1G4I5Y9_TRYEQ) Uncharacterized protein {ECO:0000313|EMBL:SCU67302.1} KW=Complete proteome OX=5694 OS=Trypanosoma equiperdum. GN=TEOVI_000042000 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MSSKSSVGSISSIQRDQEYLHSHNVRGMLELLIADVILERPENACEYFALWASRKQRERN
AENTSGGQAPTSAAGS
Download sequence
Identical sequences A0A1G4I5Y9 C9ZXD2 Q38FM2
5691.Tb09.160.1690 XP_011776347.1.14543 XP_803608.1.54365 Tb427tmp.160.1690 gi|71744196|ref|XP_803608.1| Tb09.160.1690 Tbg972.9.1510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]