SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4IHP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1G4IHP9
Domain Number - Region: 29-53,107-136
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0314
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4IHP9
Sequence length 198
Comment (tr|A0A1G4IHP9|A0A1G4IHP9_TRYEQ) Uncharacterized protein {ECO:0000313|EMBL:SCU71961.1} KW=Complete proteome OX=5694 OS=Trypanosoma equiperdum. GN=TEOVI_000354300 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MGQKPSITTLLRQCIYNQDTDGFRALIGEHENELIPGCLEDNIFVEVITKKCEPEIVDTV
VKLANENQLASLVATAVLYDHSLPLGPLFGMMKERERTIEEHQLKYLFLTLCERGRTEAV
RVFVENKCYDPSDPRPLRAVVRGQLKNPNVDTDLLMLVLSSHAPQPDDVKCLIETYLAEA
ENGDVRKVVEKCLVGFHQ
Download sequence
Identical sequences A0A1G4IHP9 C9ZS55 D6XK81
5691.Tb927.7.1630a Tb427.07.1630 gi|72390986|ref|XP_845787.1| Tb927.7.1630 XP_011774474.1.14543 XP_845787.1.54365 Tbg972.7.1640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]