SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4K941 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4K941
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 5.49e-57
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.000000705
Further Details:      
 
Domain Number 2 Region: 274-416
Classification Level Classification E-value
Superfamily L30e-like 1.37e-48
Family ERF1/Dom34 C-terminal domain-like 0.00000903
Further Details:      
 
Domain Number 3 Region: 140-272
Classification Level Classification E-value
Superfamily Translational machinery components 1.44e-48
Family ERF1/Dom34 middle domain-like 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4K941
Sequence length 437
Comment (tr|A0A1G4K941|A0A1G4K941_9SACH) LAME_0G10836g1_1 {ECO:0000313|EMBL:SCV00604.1} KW=Complete proteome OX=1266667 OS=Lachancea meyersii CBS 8951. GN=LAME_0G10836G OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
METDAEKNIAIWKVKKLIKSLEKARGNGTSMISLVIPPKGQVSMIQRMLTDEYGTASNIK
SRVNRLSVLGAITSTQQKLKLYTRVPPNGLVLYCGDIITEEGKEKKVTIDIEPYKPINTS
LYLCDNKFHTDVLSELLEADDKFGFIVMDGQGSLFGLLSGNTRTVLHKFTVDLPKKHGRG
GQSAVRFARLREEKRHNYVRKVAEVAVQNFITNDKPNVKGLILAGSADFKTDLAKSELFD
QRLASRVVKIVDISYGGENGFNQAIEQSAEALANVKFIQEKKLITSYFDEISQDTGKFCY
GIDDTLKALDLGAVETLIIFENLETVRYIFHDSEENEVIRFAEPEQEDKSYNIDKGTGLE
MEIAEEQPLVEWLAENYKNYGANLEFVTDRSSEGAQFVTGFGGIGAMLRYKVNFEQLVDE
SDDEYYEEDEGSDYDFI
Download sequence
Identical sequences A0A1G4K941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]