SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4MKY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4MKY3
Domain Number 1 Region: 89-196
Classification Level Classification E-value
Superfamily GINS helical bundle-like 5.07e-30
Family PSF2 C-terminal domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 11-87
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.00000000137
Family PSF2 N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G4MKY3
Sequence length 208
Comment (tr|A0A1G4MKY3|A0A1G4MKY3_LACFM) DNA replication complex GINS protein PSF2 {ECO:0000256|PIRNR:PIRNR028998} KW=Complete proteome; Reference proteome OX=4955 OS=Lachancea fermentati (Zygosaccharomyces fermentati). GN=LAFE_0H13476G OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
MSLPPNLQQSFSPEEIQFIVENEPIKIFSRITTRPSVRQRNSSQNSARWKLVTADDEPLN
NLVAMQTTEVALWVALLLKQQGKCSIVAPSWLTARQLQKYTDYERKHPERFSDLPWNWLV
VAQLLFIKAADDLHDPVHVLRGIVQDLREIRLSKISQGLKQLNESHLQLDNLSLLEINEL
RPFILGVMNKLKQVHSSLTTDQDDEDVF
Download sequence
Identical sequences A0A1G4MKY3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]