SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G5FVF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G5FVF6
Domain Number 1 Region: 15-212
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 5.36e-22
Family Archaeal IMP cyclohydrolase PurO 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G5FVF6
Sequence length 238
Comment (tr|A0A1G5FVF6|A0A1G5FVF6_9FIRM) IMP cyclohydrolase-like protein {ECO:0000313|EMBL:SCY43312.1} KW=Complete proteome; Reference proteome OX=1520825 OS=Lachnospiraceae bacterium XPB1003. GN=SAMN02910370_02560 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MKKNDLAELLKNNAYPGRGIVIGKSDDGKYAVTAYFIMGRSENSRNRVFVTEGEGIRTEA
FDPSKMQDPSLIIYAPVRVLGNDTIVTNGDQTDTVYEGMGKHLTFEQSLRSREFEPDAPN
YTPRISGVLHVENGNYDYSMSILKSADGDPSSCLRYTFAYENPKAGDGRFIHTYMNDGNP
LPSFEGEPELVGIEGNIESFTAKVWEALNPDNKVSLFVRFIDIETGKYETRIMNKNVK
Download sequence
Identical sequences A0A1G5FVF6
WP_089845187.1.71980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]