SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G5PAR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G5PAR0
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily RPA2825-like 2.09e-44
Family RPA2825-like 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G5PAR0
Sequence length 134
Comment (tr|A0A1G5PAR0|A0A1G5PAR0_9PSED) Uncharacterized protein {ECO:0000313|EMBL:SCZ46199.1} KW=Complete proteome OX=237610 OS=Pseudomonas psychrotolerans. GN=SAMN05216279_110224 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSLFSKILSKLGIGEAHADTPAAAPTTGATDTAAPAGSPAAPTGATPMSQVDVAAKLDGL
AAQKGEQLNWKTSIVDLLKLLDLDSSLTARQELAKELNCPADKMGDSAQMNMWLHKAVLQ
KLADNGGNVPADLL
Download sequence
Identical sequences A0A0D7FF31 A0A1G5PAR0 A0A257C2R4
WP_007162747.1.12146 WP_007162747.1.21585 WP_007162747.1.33571 WP_007162747.1.35344 WP_007162747.1.36671 WP_007162747.1.48653 WP_007162747.1.56613 WP_007162747.1.79521 WP_007162747.1.83841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]