SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G5PW74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G5PW74
Domain Number 1 Region: 10-132
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.27e-27
Family Thiamin pyrophosphokinase, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 130-203
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000968
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G5PW74
Sequence length 217
Comment (tr|A0A1G5PW74|A0A1G5PW74_9RHOB) Thiamine diphosphokinase {ECO:0000313|EMBL:SCZ53476.1} KW=Complete proteome; Reference proteome OX=1156985 OS=Epibacterium ulvae. GN=SAMN04488118_102143 OC=Rhodobacteraceae; Epibacterium.
Sequence
MTQLIVEQAGPVTLVGGGALQAEDLRVAQTLAPYVVAADSGADQALAQGVRPDLTIGDLD
SISAEARVRLGAAGLCHIGEQDSTDFDKALRAISAPVVLAVGFLGARLDHQLAVLHSLVQ
PGRSPCILIGAHEIVFHLTHRLEVSCAPEEPVSLFSLTGVQGRSTGLRWPIDGLTFHPMQ
QIGTSNKAQGPITLEADGPGMLVMLQKSHLKTVMAQV
Download sequence
Identical sequences A0A1G5PW74
WP_090216146.1.39905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]