SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G6SID5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G6SID5
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily LigT-like 0.000000000314
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G6SID5
Sequence length 179
Comment (tr|A0A1G6SID5|A0A1G6SID5_9ACTN) 2'-5' RNA ligase superfamily protein {ECO:0000313|EMBL:SDD15885.1} KW=Complete proteome; Reference proteome OX=675864 OS=Auraticoccus monumenti. GN=SAMN04489747_0321 OC=Auraticoccus.
Sequence
MLHVELLPDDPFETRLRADWEALERLDLPNLSRHRSTSNRPHVTLSVHSDDVLADDPAGG
RPRGPAREALADRLQQGLPLPLRLGALSVFGSGPYVLVRTLVVSTGLLALHAGVQELLGP
PCVAHCEVGRWVPHTTVAHRLDADQVARALSVLDPSPPPGTLVRARLWDSTRRVLEDLA
Download sequence
Identical sequences A0A1G6SID5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]