SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G7PDG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G7PDG4
Domain Number 1 Region: 41-89
Classification Level Classification E-value
Superfamily BAS1536-like 0.000017
Family BAS1536-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G7PDG4
Sequence length 91
Comment (tr|A0A1G7PDG4|A0A1G7PDG4_9BACL) Spo0E like sporulation regulatory protein {ECO:0000313|EMBL:SDF83659.1} KW=Complete proteome; Reference proteome OX=670482 OS=Fontibacillus panacisegetis. GN=SAMN04488542_11835 OC=Fontibacillus.
Sequence
MGCGGYEISLELSRFMIAEDNKLNQWTDEASHKTSPQAITLEDEIRLLRSKMELLFQQEK
SFTSDIVIEISRLLDLKINEFMLKSQNYKKK
Download sequence
Identical sequences A0A1G7PDG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]