SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G9AGW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G9AGW2
Domain Number 1 Region: 6-48
Classification Level Classification E-value
Superfamily BAS1536-like 0.000000000123
Family BAS1536-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G9AGW2
Sequence length 52
Comment (tr|A0A1G9AGW2|A0A1G9AGW2_9BACI) Spo0E like sporulation regulatory protein {ECO:0000313|EMBL:SDK26599.1} KW=Complete proteome; Reference proteome OX=407036 OS=Sediminibacillus albus. GN=SAMN05216243_2510 OC=Sediminibacillus.
Sequence
MDMKMYLLEKIEACRKEMLELSSKKDLTSETVISASTRLDYWLNQYEKAESD
Download sequence
Identical sequences A0A1G9AGW2
WP_093214730.1.56504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]