SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G9PEB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G9PEB7
Domain Number 1 Region: 8-52
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000000000000706
Family BAS1536-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G9PEB7
Sequence length 59
Comment (tr|A0A1G9PEB7|A0A1G9PEB7_9BACI) Spo0E like sporulation regulatory protein {ECO:0000313|EMBL:SDL96811.1} KW=Complete proteome; Reference proteome OX=1882761 OS=Bacillus sp. OK048. GN=SAMN05443253_101320 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIKQDHITLIEKKRAELIQVAVTNGLTSSIAIRYSQELDHLLNEYNRKYIKKARQVASL
Download sequence
Identical sequences A0A1G9PEB7
WP_090757890.1.45817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]