SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G9SFN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G9SFN5
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily BAS1536-like 0.000000000275
Family BAS1536-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G9SFN5
Sequence length 61
Comment (tr|A0A1G9SFN5|A0A1G9SFN5_9BACL) Spo0E like sporulation regulatory protein {ECO:0000313|EMBL:SDM34107.1} KW=Complete proteome OX=682956 OS=Paenibacillus jilunlii. GN=SAMN05216191_111211 OC=Paenibacillus.
Sequence
MGDKQHQARIELARKELHALALELGISHPRVLSQSVKLDMLINEYIECQADETGEMTRRD
H
Download sequence
Identical sequences A0A1G9SFN5
WP_062523421.1.57167 WP_062523421.1.90334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]