SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H0S4E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H0S4E6
Domain Number 1 Region: 61-146
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.0000000128
Family Crystallins/Ca-binding development proteins 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H0S4E6
Sequence length 152
Comment (tr|A0A1H0S4E6|A0A1H0S4E6_9ACTN) Peptidase inhibitor family I36 {ECO:0000313|EMBL:SDP36537.1} KW=Complete proteome; Reference proteome OX=310781 OS=Streptomyces guanduensis. GN=SAMN05216259_12556 OC=Streptomyces.
Sequence
MSQIIRRSIATGTAVAVFALLAVTSATEAAAVPSAGPSSFRQGPAATADNSIHPNIKSPD
VWFYTDANYSGDQADAGTQSPNFGGFNDRVSSIIIYNDLQSFCFYVDANYSGASFMSPSD
TSGNRYYPDLSIPNPFWNDALSSFRPALLGSC
Download sequence
Identical sequences A0A1H0S4E6
WP_093788448.1.57799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]