SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H1EPY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H1EPY7
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 3.27e-68
Family Archaeal IMP cyclohydrolase PurO 0.00000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H1EPY7
Sequence length 200
Comment (tr|A0A1H1EPY7|A0A1H1EPY7_9EURY) Inosinicase {ECO:0000256|HAMAP-Rule:MF_00705} KW=Complete proteome; Reference proteome OX=1236180 OS=Halopelagius longus. GN=SAMN05216278_3001 OC=Archaea; Euryarchaeota; Halobacteria; Haloferacales; Haloferacaceae.
Sequence
MYVGRFIVVGPDFGAYRVSSRSFPNRRIVDRDGTLTVAPTPDAPESDNPYISYNCVREGG
DAVVVGNGSHVDPIAEKLDLGYPARDALAESLLALDYEKDDYDTPRIAGVVTDDDAEEDS
YVGVVRRDALLVKAVSEPTLVATYEEDAPTPVEFEASDAESAASGVYEMEYEHAVCAAGV
TYRDGEVAVAVENGPDGDGE
Download sequence
Identical sequences A0A1H1EPY7
WP_092538475.1.51433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]