SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H1VIS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H1VIS6
Domain Number 1 Region: 109-168
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.0000000101
Family Crystallins/Ca-binding development proteins 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1H1VIS6
Sequence length 177
Comment (tr|A0A1H1VIS6|A0A1H1VIS6_9MICO) Uncharacterized protein {ECO:0000313|EMBL:SDS84672.1} KW=Complete proteome OX=412690 OS=Microterricola viridarii. GN=SAMN04489834_2275 OC=Microterricola.
Sequence
MKNRIVQCVGAVIGAVALSLGSATTAVAVESSPAVEHCAVEAAQLGSTEELAEPVCFGTT
DGLNAFLEKVGAGNAARGVTANVLLGTVYKDANGTGASLAFYGSSGCAEVTFGFSTLTAG
WDNSISSARGSNGCWLTLYTATNYGGSKLNCTPYCSSIGGWNDNVKSLVFRPAGTFG
Download sequence
Identical sequences A0A1H1VIS6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]