SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H2T3H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H2T3H0
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 4.19e-30
Family CobE/GbiG C-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H2T3H0
Sequence length 129
Comment (tr|A0A1H2T3H0|A0A1H2T3H0_THIRO) Cobalt-precorrin 5A hydrolase {ECO:0000313|EMBL:SDW37829.1} KW=Complete proteome OX=1058 OS=Thiocapsa roseopersicina. GN=SAMN05421783_103254 OC=Chromatiaceae; Thiocapsa.
Sequence
MEVAMGIGCDRGAAFGTLEAALAAALALIGPVDVRWLATIDRKGDEPAILALAAARRWPL
VIYPATALACIEVPNPSAQVLRHLGVPAVAEAAALLAAGADIVDLLLEKYKYRGEDGKHV
TLSIAAWRR
Download sequence
Identical sequences A0A1H2T3H0
WP_093028859.1.64216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]