SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H2Z4W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H2Z4W8
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily MTH889-like 2.49e-30
Family MTH889-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H2Z4W8
Sequence length 96
Comment (tr|A0A1H2Z4W8|A0A1H2Z4W8_HALVA) Uncharacterized protein {ECO:0000313|EMBL:SDX12472.1} KW=Complete proteome OX=28442 OS=Haloarcula vallismortis (Halobacterium vallismortis). GN=SAMN05443574_1156 OC=Haloarcula.
Sequence
MAAVRRLVIDVLKPHDPPLLTFTDQLAEIASVDGATASLIELDQEVQNVKLTFEGDDLDF
EAIDETIENLGGSVHSVDQVACGDAVVTDRRTLQDG
Download sequence
Identical sequences A0A1H2Z4W8 M0J7G2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]