SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H3JCX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H3JCX1
Domain Number 1 Region: 11-141
Classification Level Classification E-value
Superfamily MTH1598-like 2.22e-29
Family MTH1598-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1H3JCX1
Sequence length 141
Comment (tr|A0A1H3JCX1|A0A1H3JCX1_9PROT) SHS2 domain-containing protein {ECO:0000313|EMBL:SDY37687.1} KW=Complete proteome; Reference proteome OX=133724 OS=Nitrosomonas sp. Nm33. GN=SAMN05421755_10195 OC=Nitrosomonadaceae; Nitrosomonas.
Sequence
MSKNTKMISLYFEHDADVGIIGRGSTIEQAFESAAEAVFSIMTNLETVQPDISVAFEFEE
EDLELALVTWLNLLLGKARELGMVFCRFHIHRQGNLWNAEALGEKWHADLERGVEVKGAT
LTMLSVKQIGAIWEARCVVDV
Download sequence
Identical sequences A0A1H3JCX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]