SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H3P6G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H3P6G8
Domain Number 1 Region: 25-213
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 2.35e-53
Family MW0975(SA0943)-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H3P6G8
Sequence length 219
Comment (tr|A0A1H3P6G8|A0A1H3P6G8_9BACI) Putative cell-wall binding lipoprotein {ECO:0000313|EMBL:SDY96671.1} KW=Complete proteome OX=1761753 OS=Bacillus sp. 166amftsu. GN=SAMN04488156_103275 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIYKKIVVVAVLSGGLSACVLYGDFGEKPEENVYTAFENAAKQEKSLFDDAKKLEGLEIE
EEELYAQIIREGKEHDKVAAKKIDQAVANVDEREKVLKNEQEVLAKASKEMKSVPSYVDK
IEDKKLQKKVEEVEEAYKNRYETFQNMNEKYVELLTIEKELYERLKVKETKLKEIGEKVK
TVNKLNEEIQKQKEVFNRYTKKYNEEKVAFYKEAKMKVK
Download sequence
Identical sequences A0A1H3P6G8
WP_090690579.1.30053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]