SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H3VG28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H3VG28
Domain Number 1 Region: 13-208
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 7.85e-23
Family Archaeal IMP cyclohydrolase PurO 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H3VG28
Sequence length 239
Comment (tr|A0A1H3VG28|A0A1H3VG28_9FIRM) IMP cyclohydrolase {ECO:0000313|EMBL:SDZ73184.1} KW=Complete proteome; Reference proteome OX=877406 OS=Lachnospiraceae bacterium NK3A20. GN=SAMN02745687_00071 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MADLEQHLRDTSYPGRGILVGRSTDGRKAVIAYFIMGRSENSRNRIFVSDGEGIRTQAFD
PSKMEDPSLIIYAPVRVLGNKTIVTNGDQTDTIYEGMDKQQTFEESLRSREFEPDGPNYT
PRISAIMHVEGGKYNFAMSILKTDDGDPETIERYTFAYEAPKAGYGRFISTYRHDGNPLP
SFEGEPMKIDFDEDFTAGIDNFTNRIWAALNEDNKVSLFTRFIDIETGRCETRIVNKNI
Download sequence
Identical sequences A0A1H3VG28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]