SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H5HRL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H5HRL2
Domain Number 1 Region: 56-143
Classification Level Classification E-value
Superfamily AbfB domain 0.0000418
Family AbfB domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1H5HRL2
Sequence length 168
Comment (tr|A0A1H5HRL2|A0A1H5HRL2_9ACTN) Phospholipase C {ECO:0000313|EMBL:SEE30549.1} KW=Complete proteome OX=67331 OS=Streptomyces misionensis. GN=SAMN04490357_7605 OC=Streptomyces.
Sequence
MALSEADFAKLGDTPITIQSTHYPNVYLRMDGTGVTAPSDPGGGKVNCQYGTGAWTTFKV
RPQADGSYAFESVAFPSVFLRMDGTGVPTNMSGGGTVNCQSFIGPYEKFRARAQPDGSFS
FESATFTNIFLRMVTGSGVTTATGPGGTVNCQYNANGGGDEKFFLDRA
Download sequence
Identical sequences A0A1H5HRL2 A0A1K2FVJ2
WP_070025704.1.24031 WP_070025704.1.3177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]