SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H6IRT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H6IRT9
Domain Number 1 Region: 283-366
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 3.49e-19
Family tRNA-intron endonuclease catalytic domain-like 0.00046
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease N-terminal domain-like 0.00000000000179
Family tRNA-intron endonuclease N-terminal domain-like 0.0058
Further Details:      
 
Domain Number 3 Region: 180-243
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease N-terminal domain-like 0.00000000000471
Family tRNA-intron endonuclease N-terminal domain-like 0.0038
Further Details:      
 
Domain Number 4 Region: 78-172
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.0000000000453
Family tRNA-intron endonuclease catalytic domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H6IRT9
Sequence length 378
Comment (tr|A0A1H6IRT9|A0A1H6IRT9_9EURY) tRNA-intron endonuclease {ECO:0000256|HAMAP-Rule:MF_01834} KW=Complete proteome; Reference proteome OX=1267564 OS=Halopenitus malekzadehii. GN=SAMN05192561_10319 OC=Halopenitus.
Sequence
MQPDGELRDDGIQVGGDARQRFYDSRGYGRPRDGNAISLTPLEAAHLLFRGDLGAVSVDG
EDLGFEAFFVHAAAVQDRFAVRFLVYADLRDRGFYLSPTREGWPGHDRQAGTDADFIVYE
RGESPPSGGIAHRLRVVGERESIPAAGLAGTTLAVVDEESDITYFETAAIDPAGGTDYDA
PQGITGVLLADRVVVWDAPTDLYDRGFYGRPLSGRAATLDGALQLSLLEAAYLAGTGSLR
LTETLALSEPVGKGSTHGGVSSDDDGSAAAAIRGRGRAVEGKKFDRRRRIYRDLRNRDIV
PKTGFKFGADFRTYLDVGTVEDLPHSEHLVRVIEPDHAFVPRELSLDVRLAGGVRKRMVF
ALTDASSIDYLSVDRLTP
Download sequence
Identical sequences A0A1H6IRT9
WP_092816496.1.44801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]