SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H6XVF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1H6XVF5
Domain Number - Region: 64-87
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0209
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H6XVF5
Sequence length 92
Comment (tr|A0A1H6XVF5|A0A1H6XVF5_9EURY) Uncharacterized protein {ECO:0000313|EMBL:SEJ28882.1} KW=Complete proteome; Reference proteome OX=1073996 OS=Halohasta litchfieldiae. GN=SAMN05444271_14017 OC=Halohasta.
Sequence
MSEHTPPSRADDESTKASEQSTRTEYVERSDVGVSLTVKLTRGTGTRDQDKIVAKAKGKT
MEDAREDMEILREYIHDLAEDARQIQPKEEDG
Download sequence
Identical sequences A0A1H6XVF5 A0A2H4Q2Y3 B9LV38
416348.Hlac_3005 gi|222475916|ref|YP_002564437.1| WP_015911523.1.44229 WP_015911523.1.58742 WP_015911523.1.66911 WP_015911523.1.80915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]