SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H8HUH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H8HUH7
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily YfbU-like 0.0000863
Family YfbU-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H8HUH7
Sequence length 76
Comment (tr|A0A1H8HUH7|A0A1H8HUH7_9PROT) Uncharacterized protein {ECO:0000313|EMBL:SEN59822.1} KW=Complete proteome OX=1231 OS=Nitrosospira multiformis. GN=SAMN05216404_105233 OC=Nitrosomonadaceae; Nitrosospira.
Sequence
MKLSDGEKLILLMLSEVFEKLKVEDSIDPTLVKNAISYDHPWALKWEYDRVSALSGKNNL
RENQVVDILNMWTLIE
Download sequence
Identical sequences A0A1H8HUH7
WP_074745975.1.22214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]