SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H8MCC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H8MCC4
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 7.85e-43
Family Methenyltetrahydrofolate cyclohydrolase-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H8MCC4
Sequence length 206
Comment (tr|A0A1H8MCC4|A0A1H8MCC4_9ACTN) Formiminotetrahydrofolate cyclodeaminase {ECO:0000313|EMBL:SEO14910.1} KW=Complete proteome; Reference proteome OX=310780 OS=Streptomyces rubidus. GN=SAMN05216267_1018134 OC=Streptomyces.
Sequence
MHDQTIGGYLERLAAREPAPGGGAAAALHAAQGAALLGMVARYTTGEKYGSHADEIERIT
LAADELRARALQLAEDDTQAFGAVADAYGLPRADDAQKALRSQAIALALAGAARPPAEVV
AAAAAVVGLAEALLPIANPSVVTDIAAATEAARAAATTARVNVEINLAGIRDEADRADLA
ATTAEVDVIASRAEAVTAAVRRQIAR
Download sequence
Identical sequences A0A1H8MCC4
WP_075017215.1.89495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]