SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H9D845 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H9D845
Domain Number 1 Region: 27-145
Classification Level Classification E-value
Superfamily TM1646-like 3.92e-32
Family TM1646-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H9D845
Sequence length 146
Comment (tr|A0A1H9D845|A0A1H9D845_9BACI) Uncharacterized protein {ECO:0000313|EMBL:SEQ09624.1} KW=Complete proteome; Reference proteome OX=571933 OS=Piscibacillus halophilus. GN=SAMN05216362_106110 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Piscibacillus.
Sequence
MKVNQDIKSTIDPTKVQAHQRKGSTTSFQQTVSSEKQKLQESQLQQLLKDLTAQGEKVAR
FRSFQDLAKYKRMVRQFMDEAVQNGLSLEQSRSWSMNGDNRNLTLIKQVDEHLIQLTDDL
LDEQKSTIDILDVIGEIKGLLLNLQV
Download sequence
Identical sequences A0A1H9D845
WP_091772957.1.34515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]