SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H9FHP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H9FHP3
Domain Number 1 Region: 28-133
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0000811
Family MukF C-terminal domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H9FHP3
Sequence length 135
Comment (tr|A0A1H9FHP3|A0A1H9FHP3_9BACI) Uncharacterized protein YoxC, contains an MCP-like domain {ECO:0000313|EMBL:SEQ37470.1} KW=Complete proteome; Reference proteome OX=571933 OS=Piscibacillus halophilus. GN=SAMN05216362_11231 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Piscibacillus.
Sequence
MLNLLHISALIAAIAFLILVIYIAYTLISVRKTFHHVANTVEGIEKQMQGITHETTELLK
KTNHLAEDISEKTDKVNVLFDGVKGIGYTVQDFNDSLQKLSEELQDQANEHAEKTSQTIK
WGEAAIHLWKKYKEK
Download sequence
Identical sequences A0A1H9FHP3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]