SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H9ZTF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H9ZTF7
Domain Number 1 Region: 6-52
Classification Level Classification E-value
Superfamily BAS1536-like 0.000000000314
Family BAS1536-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H9ZTF7
Sequence length 54
Comment (tr|A0A1H9ZTF7|A0A1H9ZTF7_9CLOT) Spo0E like sporulation regulatory protein {ECO:0000313|EMBL:SES84108.1} KW=Complete proteome; Reference proteome OX=426128 OS=Natronincola peptidivorans. GN=SAMN05660297_00684 OC=Natronincola.
Sequence
MNQLLKLEKKIRKTRKKLHQLIKDKDGNLLDPEVVEASQELDVFMVNYSEMLRN
Download sequence
Identical sequences A0A1H9ZTF7
WP_090439339.1.99585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]