SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I0FNE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I0FNE4
Domain Number 1 Region: 32-145
Classification Level Classification E-value
Superfamily TM1646-like 6.8e-34
Family TM1646-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I0FNE4
Sequence length 146
Comment (tr|A0A1I0FNE4|A0A1I0FNE4_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:SET59882.1} KW=Complete proteome; Reference proteome OX=29364 OS=[Clostridium] polysaccharolyticum. GN=SAMN04487772_13424 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MDIKINQMQQINQAEKPQQVQQTDETFKFMLASNIEDATLQERLTLVMEDIVQQGKRLGK
HMDVRDMKRYRALIKEFMNEVVNRSHKFSRENFLDRKGRHRVYGIIKLVDDKLDELAQEL
IKDEKDHIAILGKIDEIRGLLLDILT
Download sequence
Identical sequences A0A1I0FNE4
WP_092478916.1.56065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]