SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I1LL71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I1LL71
Domain Number 1 Region: 8-141
Classification Level Classification E-value
Superfamily MTH1598-like 0.0000000000000353
Family MTH1598-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I1LL71
Sequence length 143
Comment (tr|A0A1I1LL71|A0A1I1LL71_9ACTN) SHS2 domain-containing protein {ECO:0000313|EMBL:SFC71063.1} KW=Complete proteome; Reference proteome OX=910347 OS=Streptomyces aidingensis. GN=SAMN05421773_105169 OC=Streptomyces.
Sequence
MEVRQAGHSSVPHLTDLRVLAWAPTREECLAQAVQAMTEAIADPASAGPGAATRELDTVI
PALRDEDLLLGLAEEFLHWLDAGGEVPVRAEVAAVPGGVRARVRLVRLRTLRTTGPAPVA
VTDRGLSIGPAPDGWHCAVTLAV
Download sequence
Identical sequences A0A1I1LL71
WP_093838745.1.17035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]