SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I1TBI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I1TBI9
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily WGR domain-like 0.0000000392
Family WGR domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I1TBI9
Sequence length 79
Comment (tr|A0A1I1TBI9|A0A1I1TBI9_9GAMM) WGR domain-containing protein {ECO:0000313|EMBL:SFD56002.1} KW=Complete proteome; Reference proteome OX=1123397 OS=Thiohalospira halophila DSM 15071. GN=SAMN05660831_01850 OC=Ectothiorhodospiraceae; Thiohalospira.
Sequence
MQTPPVEGKNPRFYQLLLQPDLLGGWNLVRESGPQGGRGQVRSEHFNTREEAEAALQRRR
DDQAKRGYRVVFTRGEEQP
Download sequence
Identical sequences A0A1I1TBI9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]