SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I1VID1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I1VID1
Domain Number 1 Region: 6-97
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000654
Family Tissue inhibitor of metalloproteinases, TIMP 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I1VID1
Sequence length 172
Comment (tr|A0A1I1VID1|A0A1I1VID1_9DELT) Uncharacterized protein {ECO:0000313|EMBL:SFD82802.1} KW=Complete proteome; Reference proteome OX=54 OS=Nannocystis exedens. GN=SAMN02745121_01680 OC=Nannocystineae; Nannocystaceae; Nannocystis.
Sequence
MPPPAPTVARDQAEAVFEGRVEHVQTSDTTGMVRYVLAVQRVFKGDLPASTTIVTRSSSA
ACGRSFVLGKHYLVYAHRTGEGDLGDTMCSRTRQMGTADEDLAALGAGTPPPAPASPETQ
SREPPRIEPPAAPPAVDGPAPATRRGCDLAASGPASLAGLALLALRRRPRRR
Download sequence
Identical sequences A0A1I1VID1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]