SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I2DS66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I2DS66
Domain Number 1 Region: 20-145
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.0000000000628
Family PA0094-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I2DS66
Sequence length 154
Comment (tr|A0A1I2DS66|A0A1I2DS66_9DELT) Uncharacterized protein {ECO:0000313|EMBL:SFE83494.1} KW=Complete proteome; Reference proteome OX=54 OS=Nannocystis exedens. GN=SAMN02745121_05735 OC=Nannocystineae; Nannocystaceae; Nannocystis.
Sequence
MKTDETMKDFEEMSAGEGMFLPIPKTWGKKALVAFTNGHEGEDGASVVVRVESTDARTKL
PRFVDGLMIELARTLPGFALIERRDTRLGGQPALEIEFTWTAQGVVYRQTHTSVMYAPGQ
VACVITSAALRRLPEFKETFEAVLQGARFTPAVK
Download sequence
Identical sequences A0A1I2DS66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]