SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I2M6W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I2M6W8
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily LigT-like 0.00000000262
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I2M6W8
Sequence length 175
Comment (tr|A0A1I2M6W8|A0A1I2M6W8_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:SFF87204.1} KW=Complete proteome; Reference proteome OX=1529 OS=Clostridium cadaveris. GN=SAMN04487885_11359 OC=Clostridium.
Sequence
MKYYIVALLDDESYKSIEPLQRNIARKYRLSRSNSTFHIPLSVIDNPNMDKFDEIISNIL
KPYKTFKVELGSTLFSDENAKTFSLEIENKGYIRRLSRIMNDTLKLHGFSVRDIETENSM
YVALNNINSVSKDLNKAYNNLSPNVKMIKINRIELWKSTGGKKEFIIKSYPLKNF
Download sequence
Identical sequences A0A1I2M6W8
WP_027639301.1.2550 WP_027639301.1.78929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]