SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I3K7Y5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I3K7Y5
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 3.53e-66
Family Archaeal IMP cyclohydrolase PurO 0.00000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I3K7Y5
Sequence length 196
Comment (tr|A0A1I3K7Y5|A0A1I3K7Y5_9EURY) Inosinicase {ECO:0000256|HAMAP-Rule:MF_00705} KW=Complete proteome OX=44930 OS=Natronobacterium gregoryi. GN=SAMN05443661_103133 OC=Natronobacterium.
Sequence
MYVGRFVVVGPEVGAYRVSSRSFPNREITARDEALTVGPTDDAPETDNPYVSYNCLRVVE
TPTGETAAFGNGSHVDPIAEKLELGYPARDALAESLLALDYEKDDYDTPRIAATIDDSGA
ALVGTVRKDALLVETVAEPTLVATYEKDSPEAFEFDAERAEEAAREAYGLELEHEVCAAG
VALTDNGFETAIENGN
Download sequence
Identical sequences A0A1I3K7Y5 L0AIG0
WP_005578293.1.6326 WP_005578293.1.71579 WP_005578293.1.8181 gi|429191733|ref|YP_007177411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]