SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I3L9Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I3L9Z8
Domain Number 1 Region: 81-254
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 4.45e-41
Family Chemotaxis phosphatase CheZ 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I3L9Z8
Sequence length 254
Comment (tr|A0A1I3L9Z8|A0A1I3L9Z8_9BRAD) Chemotaxis protein CheZ {ECO:0000313|EMBL:SFI81567.1} KW=Complete proteome; Reference proteome OX=1855318 OS=Bradyrhizobium sp. Gha. GN=SAMN05216525_11458 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MAVHRKRFRVEDIAGGEMPVLDVTEESGPMHTEIMAELRAIRAQMARSGQAALPPSEGVV
AQEVAETRALLDTYRAQIEQCEKLKVELDLIHDAIDRTKREIATLHGKSFDGGEMAKVNG
ELGAVVGGTEQATQQILEAAESIDQAASAMSKVQSADQQKRLADDIQERVISIFEACNFQ
DLTGQRISKVMNTMKFIEQHINSMMDIWGGVDAIKSHAPVPVDTRSEDEKLLNGPKLAGD
VGHASQDDIDALFD
Download sequence
Identical sequences A0A1I3L9Z8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]