SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I3MWE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I3MWE4
Domain Number 1 Region: 12-130
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.96e-28
Family Thiamin pyrophosphokinase, catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 130-207
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000000000144
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I3MWE4
Sequence length 228
Comment (tr|A0A1I3MWE4|A0A1I3MWE4_9RHOB) Thiamine pyrophosphokinase {ECO:0000313|EMBL:SFJ01269.1} KW=Complete proteome; Reference proteome OX=576117 OS=Celeribacter halophilus. GN=SAMN04488138_101178 OC=Rhodobacteraceae; Celeribacter.
Sequence
MNSIEPVIITRKNVTLLGGGTVCPLVLQETMKKAPCLVAADGAAGQALEMGIMPERVIGD
FDSLTEAHRARIPADRLCHVPEQDSTDFEKCLTRIDAPMIFGVGFTGARIDHELAVYATL
TRFAHRRCVILGAEDVSFMAPPELTLPTTVGQRVSLFPMAAVQGRSDGLRWPIDGLPFAP
DGRIGTSNEAVGPSVHLQFDQPGMMVILPRAACDADLVSRLIAAPVWA
Download sequence
Identical sequences A0A1I3MWE4
WP_066603211.1.74966 WP_066603211.1.91320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]