SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I4PDW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I4PDW1
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily BAS1536-like 0.00000000000353
Family BAS1536-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I4PDW1
Sequence length 55
Comment (tr|A0A1I4PDW1|A0A1I4PDW1_9FIRM) Spo0E like sporulation regulatory protein {ECO:0000313|EMBL:SFM25919.1} KW=Complete proteome OX=1123291 OS=Pelosinus propionicus DSM 13327. GN=SAMN04490355_10625 OC=Pelosinus.
Sequence
MKIGEIVEKIERTRRQLNEIGGKQCLVDAEVIKISQQLDDLIIIYQKLLSQRDGK
Download sequence
Identical sequences A0A1I4PDW1
WP_090943172.1.61203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]