SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I4RFC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I4RFC8
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily MTH1598-like 1.44e-28
Family MTH1598-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I4RFC8
Sequence length 147
Comment (tr|A0A1I4RFC8|A0A1I4RFC8_9DELT) SHS2 domain-containing protein {ECO:0000313|EMBL:SFM50961.1} KW=Complete proteome; Reference proteome OX=39841 OS=Thermodesulforhabdus norvegica. GN=SAMN05660836_00589 OC=Syntrophobacteraceae; Thermodesulforhabdus.
Sequence
MPYEYIEDWAPADQAFRAWGNAMEELFRSAVDALLGVMVSDPDLIYPEKKRNLSLREESP
EFLLYQLLREIIYLKDSEHLLLRIGTDTRDLLIRQEKDGWFLDCNLLGQNLNAYRGEFLV
DVKAVTLHRFSLMKTDRGWEATVVVDI
Download sequence
Identical sequences A0A1I4RFC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]