SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I6WQF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I6WQF5
Domain Number 1 Region: 13-203
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 2.75e-22
Family Archaeal IMP cyclohydrolase PurO 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I6WQF5
Sequence length 234
Comment (tr|A0A1I6WQF5|A0A1I6WQF5_9BACL) IMP cyclohydrolase-like protein {ECO:0000313|EMBL:SFT28233.1} KW=Complete proteome; Reference proteome OX=1881032 OS=Paenibacillus sp. BC26. GN=SAMN05428962_6320 OC=Paenibacillus.
Sequence
MKSYQQELFEKPYPGRTLIAGMTPSGTHYVQVYWIMGRSVNSRNRIFEQDGLYVRNKAFD
PALMEDPSLIIYYPIRHWGDAHIVSNGDQTDTIYEGLQLRQTFEQALMNREFEPDSPHFT
PRISAVIYADVQQYELSILKTYDNDPSVCLRNRYHFSRFKLGTGHCIHTYEAERDGVLKP
FKGDPFEVPLFDSIEETADFYWEGINPDNRISLLVKSISVEDQTIQYAFRNKHV
Download sequence
Identical sequences A0A1I6WQF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]