SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7Q3Z7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7Q3Z7
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-50
Family Calponin-homology domain, CH-domain 0.000000195
Further Details:      
 
Domain Number 2 Region: 191-249
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.09e-20
Family EB1 dimerisation domain-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I7Q3Z7
Sequence length 263
Comment (tr|A0A1I7Q3Z7|A0A1I7Q3Z7_CHICK) Microtubule-associated protein RP/EB family member 1 {ECO:0000313|Ensembl:ENSGALP00000010754} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=MAPRE1 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLQLTLTKIEQLCSGAAYCQFMDMLFPGSVALKK
VKFQAKLEHEYIQNFKVLQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPVAARQGQETVAPNLVAPVVNKPKKPLGTGSAAPQRPIVAQRTPATPKGSTGMVK
KAAGDDESAGLIEQINVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVEI
LYATDEGFVIPDEGAPQEEQEEY
Download sequence
Identical sequences A0A1I7Q3Z7
XP_015151889.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]