SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7T3Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7T3Q8
Domain Number 1 Region: 185-256
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.31e-22
Family Skp1 dimerisation domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 104-172
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000576
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I7T3Q8
Sequence length 317
Comment (tr|A0A1I7T3Q8|A0A1I7T3Q8_9PELO) Uncharacterized protein {ECO:0000313|WBParaSite:Csp11.Scaffold492.g2122.t1} KW=Complete proteome; Reference proteome OX=1561998 OS=Caenorhabditis tropicalis. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MESLLYLHSFSHHSTFTHWSSTPLLFSSPIPFGLFQLIFSPTVPLVVPFLRNISSIIDFS
QPSITIFFIPDQILNQSIQLLTMAAVDAPVVPVAAVPSEPEIIYKVSSEEGTEFKVSDGA
LRMSETMNAMLGTNPMTAEDVEKNEAIPINNIKAEILELVFKWCEEHKGEPIPVDDDTVP
KNVTIPAFDEKLMDIDNDKLFHLICAANYLNVKGLLNVSCKKVALMAKGKSPEELRVIYG
IPTDEEDEAAAKVAKEEAEKKKSEKDAEKKAIEAPGAEETKEDEGKADEKTEEAKGETSV
EKKADETNDSGEGTSSA
Download sequence
Identical sequences A0A1I7T3Q8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]