SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7U8U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7U8U2
Domain Number 1 Region: 10-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.27e-18
Family Txnl5-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I7U8U2
Sequence length 130
Comment (tr|A0A1I7U8U2|A0A1I7U8U2_9PELO) Uncharacterized protein {ECO:0000313|WBParaSite:Csp11.Scaffold629.g16026.t1} KW=Complete proteome; Reference proteome OX=1561998 OS=Caenorhabditis tropicalis. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSLKLYTAQGYEAFQQVLETIGKGKRVVALFTGSKSLSTGQSWCPDCVVAEPIVEEVIKE
ADVAALDVHFVTVFVGNREVWRDPAVGFRTDPKLKLTCIPTLLEVGNKAKRLLEGQVANK
NLVKEFFTEE
Download sequence
Identical sequences A0A1I7U8U2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]