SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7UF67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7UF67
Domain Number 1 Region: 24-88
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000863
Family BTB/POZ domain 0.0027
Further Details:      
 
Domain Number 2 Region: 98-131
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000392
Family Skp1 dimerisation domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I7UF67
Sequence length 147
Comment (tr|A0A1I7UF67|A0A1I7UF67_9PELO) Uncharacterized protein {ECO:0000313|WBParaSite:Csp11.Scaffold629.g8703.t1} KW=Complete proteome; Reference proteome OX=1561998 OS=Caenorhabditis tropicalis. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MADANVPVVQISKEPIPSDPEMIYTVTSEEGIEFRVSDKALRMSETMNAMLGATPEDVAR
NDAIPINNIKGDILELVFKWCEEHKGESIPVDDGSIPKNVTTTDFDEKLMDIDNDKLFNL
ICAANYLNVKGXXXXXXXXSFFLKLKH
Download sequence
Identical sequences A0A1I7UF67

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]