SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7V004 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7V004
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 4.71e-22
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0014
Further Details:      
 
Domain Number 2 Region: 79-189
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000096
Family Cold shock DNA-binding domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I7V004
Sequence length 214
Comment (tr|A0A1I7V004|A0A1I7V004_9PELO) Uncharacterized protein {ECO:0000313|WBParaSite:Csp11.Scaffold630.g21040.t2} KW=Complete proteome; Reference proteome OX=1561998 OS=Caenorhabditis tropicalis. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MFILSLLRDTVAIKPHQLSSDQQMVIKKRLNERLANKVVPDLGLCICVYDIKEIGDSYIL
PGEGDCRARVTFRMIVFRPFVDEVIEAKVIESSRQGLTLSIEFFEDIFVPAEKLPEPHVF
EEDGQVWYWEYAQEDGEPPAKLYMDPGKIVRFRTTEIIFKDLKPELTIEQQKTEKSMEVK
GTMASTGLGCVGWWTSDENEEEEAVEDEQDEETK
Download sequence
Identical sequences A0A1I7V004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]