SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7VXI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1I7VXI6
Domain Number - Region: 128-163
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I7VXI6
Sequence length 184
Comment (tr|A0A1I7VXI6|A0A1I7VXI6_LOALO) Uncharacterized protein {ECO:0000313|EMBL:EFO22751.1, ECO:0000313|WBParaSite:EN70_7370} KW=Complete proteome; Reference proteome OX=7209 OS=Loa loa (Eye worm) (Filaria loa). GN=LOAG_05734 OC=Spiruromorpha; Filarioidea; Onchocercidae; Loa.
Sequence
MGVVRVFLLDGVDKLTVSLGYLHVRRAVRRLRMSAMEVTETPAAESEEMKDQVEEMQQQK
LEETKKEETPAQEETTKAVDSALSHPSATSENTETSAESEKKDTPQTGGESGSGDTATTA
STTIPTRQYLDQTVVPILLQALGALAKERPPNPIEYLANYLLKEKDRFSTSFSQQQQQQN
ESSH
Download sequence
Identical sequences A0A1I7VXI6
LOAG_05734T0 XP_003141319.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]