SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7X7N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7X7N5
Domain Number 1 Region: 31-76
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.000000000000196
Family Small-conductance potassium channel 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I7X7N5
Sequence length 269
Comment (tr|A0A1I7X7N5|A0A1I7X7N5_HETBA) Uncharacterized protein {ECO:0000313|WBParaSite:Hba_13581} KW=Complete proteome; Reference proteome OX=37862 OS=Heterorhabditis bacteriophora (Entomopathogenic nematode). GN= OC=Rhabditoidea; Heterorhabditidae; Heterorhabditis.
Sequence
MRPNACENTTIDALTKQIMALSTYDNGINKIRPCRFIHKYKKAQHKGDDLRLRHHQRRFL
HSINEFRRIKWDQRMNILDNCSVRIKLKTKNNTRYKIWFLQLTKFDYYFIVIFNLLQLHS
DMHETLWEMHRTQDHFISQIDVLTQRIIELQNTLVTQSLLQRGQATACSQQLIPTHSQCF
ASAPTPSPSLPNQQPLADFSQTHREPLQQMNSSTSIPRISVAHNNNGPIRLQGTNGSLPQ
CTVDQLSSCPTGGVYATVTTPLMHSFEEV
Download sequence
Identical sequences A0A1I7X7N5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]