SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7Z470 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7Z470
Domain Number 1 Region: 368-481
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.8e-30
Family cAMP-binding domain 0.00000798
Further Details:      
 
Domain Number 2 Region: 489-609
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.86e-29
Family cAMP-binding domain 0.00000866
Further Details:      
 
Domain Number 3 Region: 262-308
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000000235
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I7Z470
Sequence length 622
Comment (tr|A0A1I7Z470|A0A1I7Z470_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:L893_g22651.t3} KW=Complete proteome; Reference proteome OX=37863 OS=Steinernema glaseri. GN= OC=Panagrolaimomorpha; Strongyloidoidea; Steinernematidae; Steinernema.
Sequence
MTTTSVVLFRSRRSFNRNPLEKRATRRRCGQTPVGSTDFHDASLPPPLGRALTQAEVQNK
KCRIELRPKNSGGPTTLFAVRYTLAGSVVYPYIATRSSSYTLAHNPARQAPGMTSLISCF
VAVVSCAPTPNRNSFPLKGCCGAAQAVALSSRSRFPSLLRGCWASEWRVAVSAKKNATAS
ERGREREDIVETIDSAFGDRRRRCRCRSRPDAVIVVGAIGGHLLALEGIAGRAHKVSTSM
QSAAEAAERMSAGGNTSEEAQLAQCQAYVQRHNIQQLVKEAIVSLCIHKPDNPILFLKHH
FDKLNEQRTQESAQGSDPVDDDDTLDEVPKPSSTNRRRLGVSAEVPDENEAANYKKIVIP
KDNETCMALEAAMGKNILFSHLDKEEKKCIFDAMFPVEKKQGETIIEQGEEGDNFYVIDN
GEVDVYVNNDYMLSIKEGGSFGELALIYGTPRAATVTAKSDVKLWAIDRITYRQILMGST
MRKRKIYDEFLSKVQILADLDKWERATVADALEMCDFEPGTHVVEQGQPGDEFFIIVEGE
ADVLQKRSDDAPFENVGHLTSSDYFGEIALLLDRPRAATVVAQTPLKCVKMDRARFERVM
GPVREILQRDVSNYNSYVKLMT
Download sequence
Identical sequences A0A1I7Z470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]