SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8B1G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8B1G3
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily GINS helical bundle-like 2.49e-28
Family PSF1 N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I8B1G3
Sequence length 223
Comment (tr|A0A1I8B1G3|A0A1I8B1G3_MELHA) Uncharacterized protein {ECO:0000313|WBParaSite:MhA1_Contig1246.frz3.gene22} KW=Complete proteome; Reference proteome OX=6305 OS=Meloidogyne hapla (Root-knot nematode worm). GN= OC=Meloidogyne.
Sequence
MAEKRQQIASAGFELVQSLHDNPDVLPPYNKELIDKCAKQIVDLYNDNIRSLIDLKAKAD
DSNKENESQVFQLVRIRQVAIDQIKRCSCAYINERMKRIKNMRWKCGGQIPEKFRNNMSE
HEQKWLKNYNELTFEFQNEFGKEDEENEEEEINGGNGVNLFNYVDPPDKLMVKVRALKDS
GQFETSDGITVVLAKGAVHLLPRQDCENLVRKGILEYVNQITD
Download sequence
Identical sequences A0A1I8B1G3
MhA1_Contig1246.frz3.gene22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]